PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_41699
Common NameKK1_040983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 295aa    MW: 33124.4 Da    PI: 6.5915
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_41699genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.32.7e-111358146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg WT+eEd   +    ++G+g+W++++++  ++R++k+c++rw +
    C.cajan_41699 13 RGVWTAEEDRNKLAFGSKHGSGNWTSVPKKARLKRCGKSCRLRWSN 58
                     899*****************************************87 PP

2Myb_DNA-binding48.71.8e-1567109246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++Tt+E++l++++++  G++ W+ Ia+ ++ gRt++++k++w++
    C.cajan_41699  67 DNFTTQEEDLIIKLHAAIGSR-WSIIAQQLP-GRTDNDVKNHWNT 109
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.43859IPR017930Myb domain
SuperFamilySSF466893.63E-2510107IPR009057Homeodomain-like
SMARTSM007172.7E-61262IPR001005SANT/Myb domain
PfamPF002497.6E-101358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-161567IPR009057Homeodomain-like
CDDcd001672.05E-61658No hitNo description
PROSITE profilePS5129423.3761115IPR017930Myb domain
SMARTSM007171.4E-1365113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2268115IPR009057Homeodomain-like
CDDcd001679.94E-1068111No hitNo description
PfamPF002491.1E-1368109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MVRSPCEKIN VKRGVWTAEE DRNKLAFGSK HGSGNWTSVP KKARLKRCGK SCRLRWSNCP  60
RPDLKHDNFT TQEEDLIIKL HAAIGSRWSI IAQQLPGRTD NDVKNHWNTK LKKKLSQMGI  120
DPVTHKPFSK LIADYGNIGG CQKPSTQIGS INKDFKNAMI THSDNISMDL AQVQGMPMMS  180
DASNCLDFEN GSVFGEDCLS KTSSPSIPST CSTSAFSWND FLLEDAFTTP FCDNHEHDML  240
MSKDLVSQIE NVTRQSSDFQ FSSSSDISFI EAMLDQENEM FLSFPHLMEE PSNLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25131157108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150352e-72AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007138144.11e-141hypothetical protein PHAVU_009G183800g
TrEMBLA0A151R5P60.0A0A151R5P6_CAJCA; Myb-related protein Zm38
STRINGGLYMA06G20020.21e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-63MYB family protein